DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and MKK3

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001318713.1 Gene:MKK3 / 834042 AraportID:AT5G40440 Length:520 Species:Arabidopsis thaliana


Alignment Length:268 Identity:91/268 - (33%)
Similarity:145/268 - (54%) Gaps:21/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLN-HPNTIEYKGCYLR 96
            ||.|:...|..|.......|:|:||::..   .:||.|.:|.|||.|.:.. |...:::.|.:..
plant    89 IGSGASSVVQRAIHIPNHRILALKKINIF---EREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYS 150

  Fly    97 ESTAW--LVMEYC-VGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGR-IHRDIKAGNIL 157
            ..:..  :.:||. .||.:||::|.|| :.|..::::...:|.||||||.:.. :|||||..|:|
plant   151 PDSGQISIALEYMNGGSLADILKVTKK-IPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLL 214

  Fly   158 LTDNGVVKLADFG-SAAIK-----CPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIE 216
            :...|..|:.||| ||.::     |.  :||||..:|:||.|   ....|....|:||||:...|
plant   215 INLKGEPKITDFGISAGLENSMAMCA--TFVGTVTYMSPERI---RNDSYSYPADIWSLGLALFE 274

  Fly   217 LAERKPPYF-NMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYV 280
            ....:.||. |...::.:..|..:.|||.||.::|..||||::.||:|.|..||::.:||:|.::
plant   275 CGTGEFPYIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFI 339

  Fly   281 TRPRSDTV 288
            |:...:.|
plant   340 TKHEKERV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 89/260 (34%)
S_TKc 27..280 CDD:214567 89/258 (34%)
MKK3NP_001318713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.