DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AT3G06640

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_187316.2 Gene:AT3G06640 / 819844 AraportID:AT3G06640 Length:730 Species:Arabidopsis thaliana


Alignment Length:318 Identity:97/318 - (30%)
Similarity:153/318 - (48%) Gaps:50/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EKIFEDL---REIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQ--SQEKWQDILKEIRFLRQLN 83
            |.:::||   .:||.||.|.||:..  .....||:|.:|   ||  |:|..|...:|:..:::|.
plant   440 EILWDDLTIGEQIGQGSCGTVYHGL--WFGSDVAVKLIS---KQEYSEEVIQSFRQEVSLMQRLR 499

  Fly    84 HPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLH--SLG 145
            |||.:.:.|.........:|.|:.. ||...:::.:...|.......:.|.:..|::|||  |..
plant   500 HPNVLLFMGAVTLPQGLCIVSEFLPRGSLFRLLQRNMSKLDWRRRINMALDIARGMNYLHRCSPP 564

  Fly   146 RIHRDIKAGNILLTDNGVVKLADFGSAAIK----CPANSFVGTPYWMAPEVILAMDEGQYDGKVD 206
            .||||:|:.|:|:..|..||:||||.:.||    ..:.|..|.|.||||||:  .:|.. |.|.|
plant   565 IIHRDLKSSNLLVDKNLTVKVADFGLSRIKHHTYLTSKSGKGMPQWMAPEVL--RNESA-DEKSD 626

  Fly   207 VWSLGITCIELAERKPPYFNMNAMSALYHIA-QNESPTLPKN---DWSDAFCSFVELCLKKMPAE 267
            ::|.|:...|||..|.|:.|:|:|..:..:. .|:...:||:   ||    .|.:|.|..:    
plant   627 IYSFGVVLWELATEKIPWENLNSMQVIGAVGFMNQRLEIPKDIDPDW----ISLIESCWHR---- 683

  Fly   268 RPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCETESA 325
               .|||       ||    ...||:.|.:...|:. .:.::..:.:.||   .|||:
plant   684 ---DAKL-------RP----TFQELMERLRDLQRKY-TIQFQATRWLTMV---RTESS 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 85/272 (31%)
S_TKc 27..280 CDD:214567 85/268 (32%)
AT3G06640NP_187316.2 PAS 64..175 CDD:279347
PAS 73..175 CDD:238075
STYKc 446..698 CDD:214568 88/281 (31%)
STKc_MAP3K-like 452..698 CDD:270901 87/275 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.