DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AT2G35050

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001325366.1 Gene:AT2G35050 / 818070 AraportID:AT2G35050 Length:1257 Species:Arabidopsis thaliana


Alignment Length:290 Identity:84/290 - (28%)
Similarity:135/290 - (46%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDLREIGHGSFGAVYYARCNLTR-EIVAIKKMSYTGKQSQEK------WQDILKEIRFLRQLNHP 85
            |:|:|:|.|:||.||:.:...|. .|..||:..:.|:.|:::      |.    |...|.:|:||
plant   975 EELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWH----EAEILSKLHHP 1035

  Fly    86 NTIEYKGCYLRE---STAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRI 147
            |.:.:.| .:::   .|...|.||.|..:...:.:..:.|...:...|.:....|:.||||...:
plant  1036 NVMAFYG-VVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIV 1099

  Fly   148 HRDIKAGNIL--LTD--NGVVKLADFGSAAIKCPANSFV-----GTPYWMAPEVILAMDEGQYDG 203
            |.|:|..|:|  |.|  ..:.|:.|||.:.||  .|:.|     ||..||||| :|:....:...
plant  1100 HFDLKCDNLLVNLKDPARPICKVGDFGLSKIK--RNTLVTGGVRGTLPWMAPE-LLSGSSSKVSE 1161

  Fly   204 KVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNE-SPTLPKNDWSDAFCS-----FVELCLK 262
            ||||:|.||...|:...:.||.||:..:.:..|..|. .||:|.      :|.     .:|.|..
plant  1162 KVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPN------YCDPEWRMLMEQCWA 1220

  Fly   263 KMPAERPSSAKLL-------THAYVTRPRS 285
            ..|..||:..::.       :.|..|:|.:
plant  1221 PDPFVRPAFPEIARRLRTMSSSAVHTKPHA 1250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 82/285 (29%)
S_TKc 27..280 CDD:214567 82/283 (29%)
AT2G35050NP_001325366.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.