DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and CPK24

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_180708.1 Gene:CPK24 / 817708 AraportID:AT2G31500 Length:582 Species:Arabidopsis thaliana


Alignment Length:337 Identity:93/337 - (27%)
Similarity:147/337 - (43%) Gaps:38/337 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PEKIFEDL-------REIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLR 80
            ||.|.:.:       :|:|.|.||..:......|||..|.|::|....:::...:|:.:|:..:|
plant    55 PEPIGDGIHLKYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEIMR 119

  Fly    81 QL-NHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSL 144
            .| .|||.:.:|..:..:...:||||.|.|.......|.:....|...|::...:|..:...|..
plant   120 CLPKHPNIVSFKEAFEDKDAVYLVMEICEGGELFDRIVSRGHYTERAAASVAKTILEVVKVCHEH 184

  Fly   145 GRIHRDIKAGNILL---TDNGVVKLADFGSAAIKCPA---NSFVGTPYWMAPEVILAMDEGQYDG 203
            |.||||:|..|.|.   |:...:|..|||.:....||   |..||:||:|||||:    ...|..
plant   185 GVIHRDLKPENFLFSNGTETAQLKAIDFGLSIFFKPAQRFNEIVGSPYYMAPEVL----RRNYGP 245

  Fly   204 KVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKM---- 264
            ::||||.|:....|....||:: ......:.|.....:....::.|........|| :|.|    
plant   246 EIDVWSAGVILYILLCGVPPFW-AETEEGIAHAIVRGNIDFERDPWPKVSHEAKEL-VKNMLDAN 308

  Fly   265 PAERPSSAKLLTHAYV-TRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMV--DTCETESAV 326
            |..|.:..::|.|.:: ...|:..|.|....|||  :::...:| |..||:|.:  |....|...
plant   309 PYSRLTVQEVLEHPWIRNAERAPNVNLGDNVRTK--IQQFLLMN-RFKKKVLRIVADNLPNEEIA 370

  Fly   327 G--------DTD 330
            .        |||
plant   371 AIVQMFQTMDTD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 75/275 (27%)
S_TKc 27..280 CDD:214567 74/270 (27%)
CPK24NP_180708.1 STKc_CAMK 65..323 CDD:270687 74/263 (28%)
FRQ1 363..512 CDD:227455 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.