DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and SIP4

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_180595.1 Gene:SIP4 / 817586 AraportID:AT2G30360 Length:435 Species:Arabidopsis thaliana


Alignment Length:324 Identity:87/324 - (26%)
Similarity:149/324 - (45%) Gaps:57/324 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKW-------QDILK 74
            ||.|::..|:      :|.|:|..|::||...|.:.||:|.:      :::|.       .:|.:
plant    17 LFGKYELGKL------LGCGAFAKVFHARDRRTGQSVAVKIL------NKKKLLTNPALANNIKR 69

  Fly    75 EIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAICLGVLSGL 138
            ||..:|:|:|||.::.......:|..:..||:.. |...:.|..|.: |.||........::|.:
plant    70 EISIMRRLSHPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGR-LSEDLSRRYFQQLISAV 133

  Fly   139 SYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP------ANSFVGTPYWMAPEVILAMD 197
            .|.|:.|..|||:|..|:|:.:||.:|::|||.:|:...      .::..|||.::|||:   :.
plant   134 GYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLHTLCGTPAYVAPEI---LS 195

  Fly   198 EGQYDG-KVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNE-------SPTLPKNDWSDAFC 254
            :..|:| ||||||.||....|.....|:.:.|.|:....|.:.|       ||.|.:        
plant   196 KKGYEGAKVDVWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEYRFPRWMSPDLKR-------- 252

  Fly   255 SFVELCLKKMPAERPSSAKLLTHAYVTRP-------RSDTVLLELIARTKSAVREL---DNLNY 308
             ||...|...|..|.:..::|...:..|.       ..|.:..:.:..:..||:.|   |.::|
plant   253 -FVSRLLDINPETRITIDEILKDPWFVRGGFKQIKFHDDEIEDQKVESSLEAVKSLNAFDLISY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 77/278 (28%)
S_TKc 27..280 CDD:214567 76/274 (28%)
SIP4NP_180595.1 PKc_like 20..276 CDD:419665 78/280 (28%)
CIPK_C 308..421 CDD:213380 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.