DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and PAK6

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001263646.1 Gene:PAK6 / 56924 HGNCID:16061 Length:681 Species:Homo sapiens


Alignment Length:306 Identity:112/306 - (36%)
Similarity:158/306 - (51%) Gaps:33/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPN 86
            ||..:.:...:||.||.|.|..||...:...||:|.|....:|.:|.   :..|:..:|...|.|
Human   402 DPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRREL---LFNEVVIMRDYQHFN 463

  Fly    87 TIEYKGCYLRESTAWLVMEYCVGSA-SDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRD 150
            .:|....||.....|::||:..|.| :||  |.:..|:|::||.:|..||..|:|||:.|.||||
Human   464 VVEMYKSYLVGEELWVLMEFLQGGALTDI--VSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRD 526

  Fly   151 IKAGNILLTDNGVVKLADFGSAA---IKCP-ANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLG 211
            ||:.:||||.:|.|||:|||..|   ...| ..|.||||||||||||   ....|..:||:||||
Human   527 IKSDSILLTLDGRVKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVI---SRSLYATEVDIWSLG 588

  Fly   212 ITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDW--SDAFCSFVELCLKKMPAERPSSAKL 274
            |..||:.:.:||||:.:.:.|:..:..:..|.| ||..  |.....|:|..|.:.|.||.::.:|
Human   589 IMVIEMVDGEPPYFSDSPVQAMKRLRDSPPPKL-KNSHKVSPVLRDFLERMLVRDPQERATAQEL 652

  Fly   275 LTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTC 320
            |.|.::.:......|:.||..            |||     ...||
Human   653 LDHPFLLQTGLPECLVPLIQL------------YRK-----QTSTC 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 102/263 (39%)
S_TKc 27..280 CDD:214567 102/259 (39%)
PAK6NP_001263646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PBD 11..67 CDD:307091
Linker 26..406 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..169
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..256
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..355
STKc_PAK6 385..681 CDD:270821 110/304 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.