DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and taok3b

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_021332191.1 Gene:taok3b / 555650 ZFINID:ZDB-GENE-060526-59 Length:438 Species:Danio rerio


Alignment Length:435 Identity:187/435 - (42%)
Similarity:285/435 - (65%) Gaps:0/435 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 MSGYKRMRREHQAHLVKLEEKCKVDMEAHKTALDKEYDTLLHNFTRDLDRLETKHQQDVERRAKQ 639
            |||||||||:||..|:.||.:.|.:|:.||..|.||.:|..:|...:|:||..|....:::..|.
Zfish     1 MSGYKRMRRQHQKQLIALENRLKAEMDEHKLRLQKEVETQANNTYIELERLAKKQATQLDKEIKA 65

  Fly   640 TSAAEKKLHKEITLKQENDRKVYDLNRKKEYKANKERWKRELSMDESTPKRQRDLTLQSQKDNLK 704
            |:|.||::.::|.::|:.:...:...:||:|:..:||.|.|::.|..|||.::...|...|:.::
Zfish    66 TAAEEKRIQQQILVQQKKELTTFLDTQKKQYRLCRERMKEEMNEDFDTPKEEKQERLSRHKETMQ 130

  Fly   705 QHEAQEEQRMLQAQKQYIELEMRKFKRKRMIMQHEHEDQQLRDELGKKEQQLQQAHAMLLKHHEK 769
            :.:|:||.::|..|:...|...|..||:.:|.:||.|.:|:|:||.||:.|.:..||::::..|.
Zfish   131 RSQAEEEAQLLNQQRLVYERSCRALKRRSLIKKHEFEQEQIREELNKKKMQKEMEHALMIRQDES 195

  Fly   770 TQELEYRQQKSVHQLREEQINKQHDTELHNQKDYMDRIKKELVRKHAVELRQQPKSLKQKELQIR 834
            |||||.||.:::.:||.|.:..||.|||.||::|..|.::||.||||:|.||||::||..|:||:
Zfish   196 TQELEQRQLQTLQRLRFELMRHQHQTELENQEEYNSRRQRELHRKHALERRQQPRNLKTLEMQIK 260

  Fly   835 KQFRETCKTQTKQYKRYKAQVLQTTPKEQQKEVIKQLKEEKHRKLTLLGEQYEQSIADMFQSQSY 899
            |||::|||.|.||||..:...|:.:||...|.::|.||||:.|||..|.|||||||.:|..|||.
Zfish   261 KQFQDTCKVQNKQYKALRNHQLEVSPKGDHKAILKSLKEEQTRKLAQLAEQYEQSINEMMASQSL 325

  Fly   900 KLDESQVIECQRTHEQLEYELEMLTAYQNKNKKQAQEQRDRERRELENRVSVRRGLLENKMDAEL 964
            :|||.|..|||...:||..|:|:|.|||||.|.|.:.|.:||.::||.:.|:||..||.|::.||
Zfish   326 RLDEEQEAECQALRQQLHQEMELLDAYQNKTKAQMEAQHEREVQKLEQKASLRRAHLEQKIEEEL 390

  Fly   965 QQFNQERAERLRMKHEKHTKELEAFDNESIALGFSTLSLIEVSRE 1009
            ...::||.|:::...|:..:|||.||.||..|||.:|:..:..::
Zfish   391 ASLHKERTEKIKHLFERQERELEMFDLESARLGFGSLASFDFPKD 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784
S_TKc 27..280 CDD:214567
taok3bXP_021332191.1 SMC_N <13..>423 CDD:330553 172/409 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277938at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24956
orthoMCL 1 0.900 - - OOG6_102967
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.