DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and sdr39u1

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001016261.1 Gene:sdr39u1 / 549015 XenbaseID:XB-GENE-1015181 Length:300 Species:Xenopus tropicalis


Alignment Length:135 Identity:29/135 - (21%)
Similarity:45/135 - (33%) Gaps:41/135 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAF-----CSFVEL------ 259
            ||..:|:         ||      ..|..::| .|:...|...|::.|     .|.:|.      
 Frog    43 DVSKIGL---------PP------CDAAVNLA-GENVLNPLKRWTEKFKQEVISSRIETTRTLTQ 91

  Fly   260 CLKKMPAERPSSAKLL-----------THAYVTR-PRSDTVLLELIARTKSAVRELDNLNYRKMK 312
            .:.|.|  .|..:.:|           ||.|... |..|...|..:.|....|.||...|.:...
 Frog    92 AISKSP--NPPQSWILVTGVGYYPPSQTHQYSEESPGGDADFLSRLVRDWEQVAELSPSNSKSST 154

  Fly   313 KILMV 317
            :::.|
 Frog   155 QLVRV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 20/97 (21%)
S_TKc 27..280 CDD:214567 19/95 (20%)
sdr39u1NP_001016261.1 SDR_a8 2..299 CDD:187553 29/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.