DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Pak

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001138013.2 Gene:Pak / 44039 FlyBaseID:FBgn0267698 Length:840 Species:Drosophila melanogaster


Alignment Length:319 Identity:126/319 - (39%)
Similarity:171/319 - (53%) Gaps:27/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSARPGS---------LKDPEIAD----LFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIV 53
            |:|.|.:         :.|.||.:    :.:..||.:.:..:.:||.|:.|.||.|..:.|...|
  Fly   528 PAATPNTRAANAKKKKMSDEEILEKLRTIVSVGDPNRKYTKMEKIGQGASGTVYTAIESSTGMEV 592

  Fly    54 AIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEV 117
            |||:|:.:   .|.|.:.|:.||..:|:..|||.:.|...||.....|:||||.. ||.:|:  |
  Fly   593 AIKQMNLS---QQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDV--V 652

  Fly   118 HKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANS-- 180
            .:..:.|.:|||:|..||..|.:||:...||||||:.||||..:|.|||.|||..|...|..|  
  Fly   653 TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKR 717

  Fly   181 --FVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPT 243
              .|||||||||||:   ...||..|||:|||||..||:.|.:|||.|.|.:.|||.||.|..|.
  Fly   718 TTMVGTPYWMAPEVV---TRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPE 779

  Fly   244 LPKND-WSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVR 301
            :.:.| .|.||..|::.||:.....|.|:..||.|.::...|....|..||...|.|.:
  Fly   780 IKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLARPLASLTPLIMAAKEATK 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 112/262 (43%)
S_TKc 27..280 CDD:214567 112/258 (43%)
PakNP_001138013.2 PBD 83..137 CDD:279166
STKc_PAK_I 558..818 CDD:270814 114/267 (43%)
S_TKc 566..817 CDD:214567 112/258 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.