DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Pak3

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster


Alignment Length:303 Identity:105/303 - (34%)
Similarity:156/303 - (51%) Gaps:29/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIR 77
            |:..:.|..||.:.::..:|:|.|:.|.|:.|........||:|.:....:.|::.   ||.|||
  Fly   279 ELRAICNSDDPRERYKTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDL---ILTEIR 340

  Fly    78 FLRQLNHPNTIEYKGCYL--RESTAWLVMEYCVGS-ASDIIEVHKKPLHEDEIAAICLGVLSGLS 139
            .|:..||.|.:.:...||  .|...|:||||..|. .:|:  |.:..:.|.:||.:|...|..:|
  Fly   341 VLKDFNHKNLVNFLDAYLLEPEDQLWVVMEYMDGGPLTDV--VTETVMKERQIACVCRETLYAIS 403

  Fly   140 YLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPAN--------SFVGTPYWMAPEVILAM 196
            :||:.|.||||||:.|:||..:|.||:.|||..     ||        :.|||||||||||:   
  Fly   404 FLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFC-----ANIEGDEKRQTMVGTPYWMAPEVV--- 460

  Fly   197 DEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDW---SDAFCSFVE 258
            ...:|..|||:||:||..||:.|.:|||.....:.|||.||.|..|.:  ..|   |.....|::
  Fly   461 TRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDI--KSWDKLSPNLQDFLD 523

  Fly   259 LCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVR 301
            .||:.....|.::.:||:|.::........|:..|...|..:|
  Fly   524 RCLQVEVDRRATADELLSHPFLNDCSEVKALVPNIKAAKKVLR 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 97/270 (36%)
S_TKc 27..280 CDD:214567 97/266 (36%)
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 99/271 (37%)
S_TKc 293..545 CDD:214567 97/266 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48015
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.