DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Mkk4

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001163551.1 Gene:Mkk4 / 41020 FlyBaseID:FBgn0024326 Length:424 Species:Drosophila melanogaster


Alignment Length:324 Identity:95/324 - (29%)
Similarity:151/324 - (46%) Gaps:43/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNH-PNTIEYK 91
            ||..|||.|:||||.........:::|:|::..|..:.::|  .:|.::..:.:.|. ...:::.
  Fly   123 EDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQK--QLLMDLEVVMKSNECIYIVQFY 185

  Fly    92 GCYLRESTAWLVMEYCVGSASD----IIEVHKKPLHEDEIAAICLGVLSGLSYL-HSLGRIHRDI 151
            |...:|...|:.||....|...    |.|..::.:.|..:|.|.:..::.|:|| ..|..||||:
  Fly   186 GALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLKEELKIIHRDV 250

  Fly   152 KAGNILLTDNGVVKLADFG-SAAIKCPANSFVGT------PYWMAPEVILAMDEGQYDGKVDVWS 209
            |..||||...|.:||.||| |..:   .:|...|      || ||||.|.......||.:.||||
  Fly   251 KPSNILLHRRGDIKLCDFGISGQL---VDSIAKTKDAGCRPY-MAPERIDPERAKGYDVRSDVWS 311

  Fly   210 LGITCIELAERKPPYFNMNAM-SALYHIAQNESPTLPKN----DWSDAFCSFVELCLKKMPAERP 269
            ||||.:|:|....||...::: ..|..:.|.|.|.|..:    ::|..|..||..||.|..::||
  Fly   312 LGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRP 376

  Fly   270 SSAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCETESAVGDTDDQQ 333
            ..::||...::.|..:        :.|..||...|           ::::.|.:.....|.:||
  Fly   377 KYSRLLEMPFIRRGET--------SHTDVAVYVAD-----------ILESMEKDGITQFTANQQ 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 86/271 (32%)
S_TKc 27..280 CDD:214567 86/269 (32%)
Mkk4NP_001163551.1 PKc_MKK4 115..405 CDD:270790 91/306 (30%)
S_TKc 123..387 CDD:214567 86/269 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.