DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and stk24b

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_005165890.1 Gene:stk24b / 406786 ZFINID:ZDB-GENE-040426-2841 Length:432 Species:Danio rerio


Alignment Length:349 Identity:139/349 - (39%)
Similarity:201/349 - (57%) Gaps:42/349 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GSLKDPEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQD 71
            |||  |.:.:|  |.|||::|..|..||.||||.|:....|.|:::||||.:..  ::::::.:|
Zfish     8 GSL--PGMQNL--KADPEELFTKLERIGKGSFGEVFKGIDNRTQKVVAIKIIDL--EEAEDEIED 66

  Fly    72 ILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYC-VGSASDIIEVHKKPLHEDEIAAICLGVL 135
            |.:||..|.|.:.|...:|.|.||:::..|::|||. .|||.|::|  ...|.|.:||.|...:|
Zfish    67 IQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLE--PGSLDETQIATILREIL 129

  Fly   136 SGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAA----IKCPANSFVGTPYWMAPEVILAM 196
            .||.||||..:|||||||.|:||::.|.|||||||.|.    .:...|:|||||:|||||||   
Zfish   130 KGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI--- 191

  Fly   197 DEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFC----SFV 257
            .:..||.|.|:||||||.||||:.:||:.:::.|..|:.|.:|..|||..|     :|    .||
Zfish   192 KQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLEGN-----YCKPLKEFV 251

  Fly   258 ELCLKKMPAERPSSAKLLTHAYVTR-PRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCE 321
            |.||.|.|:.||::.:||.|..:.| .:..:.|.|||.:            |::.|    .:...
Zfish   252 EACLNKEPSFRPTAKELLKHKLIVRFAKKTSYLTELIDK------------YKRWK----AEQSR 300

  Fly   322 TESAVGDTDDQQDDHAGGDSSKSN 345
            .||:..::|.:.|..|.|.:...|
Zfish   301 AESSSDESDSEPDGQASGGNDFGN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 116/265 (44%)
S_TKc 27..280 CDD:214567 116/261 (44%)
stk24bXP_005165890.1 STKc_MST3_like 22..295 CDD:270786 122/296 (41%)
S_TKc 24..274 CDD:214567 116/261 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.