DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and akt2l

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_021334818.1 Gene:akt2l / 403146 ZFINID:ZDB-GENE-040121-5 Length:625 Species:Danio rerio


Alignment Length:283 Identity:72/283 - (25%)
Similarity:124/283 - (43%) Gaps:36/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FEDLREIGHGSFGAV----------YYARCNLTREIVAIK-KMSYTGKQSQEKWQDILKEIRFLR 80
            |:.|:.:|.|:||.|          |||...|.:|::..| ::::|           :.|.|.|:
Zfish   149 FDYLKLLGKGTFGKVILVREKASGMYYAMKILRKEVIIAKDEVAHT-----------VTESRVLQ 202

  Fly    81 QLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLG 145
            ...||.....|..:........||||..|.........::...||........::|.|.|.||..
Zfish   203 NTRHPFLTTLKYAFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYPHSQN 267

  Fly   146 RIHRDIKAGNILLTDNGVVKLADFG----SAAIKCPANSFVGTPYWMAPEVILAMDEGQYDGKVD 206
            .::|.:|..|::|.::|.:|:.|||    ....:....:|.|||.::||||   :::..|...||
Zfish   268 VVYRHLKLENLMLDNDGHIKITDFGLCKEGITDEATMRTFCGTPEYLAPEV---LEDNDYGRAVD 329

  Fly   207 VWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAER--- 268
            .|.||:...|:...:.|:::.:.......|...|. ..|::..:.|......| |:|.|.:|   
Zfish   330 WWGLGVVMYEMMCGRLPFYSQDHERLFEQIVMEEI-RFPRSLSTHARALLTGL-LRKEPKQRLGG 392

  Fly   269 -PSSAK-LLTHAYVTRPRSDTVL 289
             |..|: ::.|.:.:..:.|.||
Zfish   393 GPDDARDVMMHKFFSGVQWDDVL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 69/274 (25%)
S_TKc 27..280 CDD:214567 69/272 (25%)
akt2lXP_021334818.1 PH_PKB 4..111 CDD:269947
PKc_like 153..462 CDD:328722 70/279 (25%)
PKc_like <423..551 CDD:328722
S_TK_X 553..621 CDD:214529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.