DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and stk4

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_989249.1 Gene:stk4 / 394860 XenbaseID:XB-GENE-955920 Length:485 Species:Xenopus tropicalis


Alignment Length:315 Identity:131/315 - (41%)
Similarity:185/315 - (58%) Gaps:15/315 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLN 83
            || .||::|:.|.::|.||:|:||.|....|.:|||||::..     :...|:|:|||..::|.:
 Frog    23 NK-QPEEVFDVLEKLGEGSYGSVYKASHKETSQIVAIKQIPV-----ESDLQEIIKEIAIMQQCD 81

  Fly    84 HPNTIEYKGCYLRESTAWLVMEYC-VGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRI 147
            ..:.::|.|.|.:.:..|:|||:| .||.||||.:.|:.|.|||.|.|....|.||.|||.:.:|
 Frog    82 SLHVVKYYGSYFKNTDLWIVMEFCGGGSISDIIRLRKQTLKEDETATILQSTLKGLEYLHFMRKI 146

  Fly   148 HRDIKAGNILLTDNGVVKLADFGSAA----IKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVW 208
            |||||||||||...|..||||||.|.    .....|:.:|||:|||||||   .|..|:...|:|
 Frog   147 HRDIKAGNILLNSEGTAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI---QEIGYNCVADIW 208

  Fly   209 SLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKND-WSDAFCSFVELCLKKMPAERPSSA 272
            |||||.||:||.||||..::.|.|::.|..|..||..|.: ||..|..|:.|||.|.|..|.|:.
 Frog   209 SLGITAIEMAEGKPPYAEIHPMRAIFMIPSNPPPTFRKPELWSKDFVDFINLCLVKNPELRSSAT 273

  Fly   273 KLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCETESAVG 327
            :||.|.::...:.:::|..||...:.|..:...|..|:::.....:..|.|:.||
 Frog   274 ELLQHPFIKTAKGESILRHLINEAQDAKLKRTELKQREVEPEEEENADEDEADVG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 117/262 (45%)
S_TKc 27..280 CDD:214567 117/258 (45%)
stk4NP_989249.1 STKc_MST1_2 26..281 CDD:132943 119/262 (45%)
Mst1_SARAH 431..478 CDD:314497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.