DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and CDKL4

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001333840.1 Gene:CDKL4 / 344387 HGNCID:19287 Length:379 Species:Homo sapiens


Alignment Length:285 Identity:81/285 - (28%)
Similarity:139/285 - (48%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYK 91
            :|.|.:.|.||:|.|:..|...:.::||:||...:......| :..|:|||.|:||.|||.:...
Human     4 YEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVK-KIALREIRMLKQLKHPNLVNLI 67

  Fly    92 GCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNI 156
            ..:.|:....||.|||..:..:.:|.:...:.:..|.::....|..|::.|....||||||..||
Human    68 EVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENI 132

  Fly   157 LLTDNGVVKLADFGSAAIKCPANS---FVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELA 218
            |:|..|::|:.|||.|.|..|.::   :|.|.::.|||:::.  :.||...||:|::|....||.
Human   133 LITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVG--DTQYGSSVDIWAIGCVFAELL 195

  Fly   219 ERKPPYFNMNAMSALYHIAQNESPTLPKND--------------------------WSDAF---C 254
            ..:|.:...:.:..||.|.:.....:|::.                          :||..   .
Human   196 TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVAL 260

  Fly   255 SFVELCLKKMPAERPSSAKLLTHAY 279
            :|::.|||..|.:|.:.::||..:|
Human   261 NFMKGCLKMNPDDRLTCSQLLESSY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 81/285 (28%)
S_TKc 27..280 CDD:214567 81/285 (28%)
CDKL4NP_001333840.1 [NKR]KIAxRE 45..51 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.