DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Wee1

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster


Alignment Length:376 Identity:86/376 - (22%)
Similarity:135/376 - (35%) Gaps:92/376 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HDP-----EKIFEDLREIGHGSFGAVYYARCNLTREIVAIKK-------MSYTGKQSQEKWQDIL 73
            ||.     ::.|..:..||.|.||.|:.....|...|.||||       .|:..:...|.|...:
  Fly   228 HDTNISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSSFEKRALNEVWAHAV 292

  Fly    74 KEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGL 138
            ..       .|.|.:.|...:..:....:..|:|.|.:.. ..:....|.|.|:..:.:.|:.||
  Fly   293 LG-------KHDNVVRYYSAWAEDDHMLIQNEFCDGGSLH-ARIQDHCLGEAELKIVLMHVIEGL 349

  Fly   139 SYLHSLGRIHRDIKAGNILLT------------------DNGV---------------VKLADFG 170
            .|:||...:|.|:|..||..|                  |:|:               .|:.|.|
  Fly   350 RYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLG 414

  Fly   171 SAAIKCPANSFVGTPY------WMAPEVILAMDEGQYDG--KVDVWSLGITCIE------LAERK 221
            ..       :.|..||      ...|:.||..|   |..  |.|::|||||..|      |.:..
  Fly   415 HV-------TSVKEPYVEEGDCRYLPKEILHED---YSNLFKADIFSLGITLFEAAGGGPLPKNG 469

  Fly   222 PPYFNMNAMSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSD 286
            |.:.|:.         ..:.|.||  ..|..|...:...:...|.:||:|..:.:|..::...|.
  Fly   470 PEWHNLR---------DGKVPILP--SLSRDFNELIAQMMHPYPDKRPTSQSIFSHPILSAVDSK 523

  Fly   287 TVL---LELIARTKSAVRELDNLNYRKMKKILMVDTCETESAVGDTDDQQD 334
            :.|   |||....:.....::.|...| |:|.:::......||.:..|..|
  Fly   524 SKLQLGLELTVEKRKNEILMNKLREAK-KQIKLLEQRVNLLAVTNNPDSLD 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 71/310 (23%)
S_TKc 27..280 CDD:214567 71/306 (23%)
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 71/306 (23%)
Pkinase 239..515 CDD:278497 70/304 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.