DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and plk3

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_958465.1 Gene:plk3 / 334202 ZFINID:ZDB-GENE-030131-6134 Length:644 Species:Danio rerio


Alignment Length:407 Identity:97/407 - (23%)
Similarity:176/407 - (43%) Gaps:42/407 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSARPGSLKD----PEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTG 62
            |.|:|...|.    ||:|.:.......:.:...:.:|.|.|...|........::.|:|.:..:.
Zfish    14 PPAKPSRSKSEHVKPELAQVVVDAKTGRSYCKGKLLGKGGFARCYEMTDLANNKMYAVKVIPQSR 78

  Fly    63 KQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEI 127
            .....:.:.|:.||...:.|.|.:.:::...:..:...::.:|.|...:...|...:..|.:.|:
Zfish    79 VSKPHQREKIINEIELHKSLQHKHVVKFSHHFEDQDNIYIFLELCSRKSLAHIWKARHTLTDPEV 143

  Fly   128 AAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAA----IKCPANSFVGTPYWM 188
            ......::|.|.|||:.|.:|||:|.||..:.:|..::|.|||.||    ::....:..|||.::
Zfish   144 RYYLRQIISSLKYLHNKGILHRDLKLGNFFVNENMELRLGDFGLAAKLETVEQRKKTICGTPNYL 208

  Fly   189 APEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKNDWSDAF 253
            ||||:.....|.   :.||||||.....|....||:..:: :...|...:....:|| :..:.:.
Zfish   209 APEVLNRQGHGT---ESDVWSLGCVMYTLLCGNPPFETLD-LKETYKCIKEVKYSLP-SSLTPSA 268

  Fly   254 CSFVELCLKKMPAERPSSAKLLTHAYVTR--------PRSDTVLLELIARTKSAVRELDNLNYRK 310
            ...:...|:|.|.:|.:..::|.|.|.|:        |.|..::.||  ...|..::.    :.|
Zfish   269 QKLISSILQKNPCDRLTLDQILAHDYFTKGFTPEKLPPSSCVMVPEL--NPPSPAKKF----FTK 327

  Fly   311 MKKILMVDTCETESAVGDTDDQQDDHAGGDSSK------SNSITSEHSIHSVGVSAASS---QSS 366
            |.|.|...  :....|..|..::.|    |.||      .:||..:.|..::||:.|:|   |.:
Zfish   328 MAKSLFGK--KKSKTVEKTTSEEKD----DISKLVSGMVKHSIGRQMSYKTMGVNEATSPTVQLA 386

  Fly   367 SSNSIPAAAQNHHHIAA 383
            ||..:...|:.....:|
Zfish   387 SSGPLDTPAEEESRKSA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 62/260 (24%)
S_TKc 27..280 CDD:214567 61/256 (24%)
plk3NP_958465.1 STKc_PLK3 41..295 CDD:271091 61/258 (24%)
S_TKc 43..295 CDD:214567 61/256 (24%)
POLO_box_1 457..545 CDD:240561
POLO_box_2 557..640 CDD:240560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.