DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and pak2b

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001020627.1 Gene:pak2b / 325034 ZFINID:ZDB-GENE-030131-3759 Length:539 Species:Danio rerio


Alignment Length:309 Identity:118/309 - (38%)
Similarity:169/309 - (54%) Gaps:20/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RP--GSLKDPEIAD----LFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGK 63
            ||  |.:.|.||.|    :.:..||:|.:....:||.|:.|.|:.|....|.:.||||:::.   
Zfish   236 RPKKGKMTDEEIMDKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINL--- 297

  Fly    64 QSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEI 127
            |.|.|.:.|:.||..:::|.:||.:.:...:|.....::||||.. ||.:|:  |.:..:.|.:|
Zfish   298 QKQPKKELIINEILVMKELKNPNIVNFLDSFLVGEELFVVMEYLAGGSLTDV--VTETCMDEAQI 360

  Fly   128 AAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANS----FVGTPYWM 188
            ||:|...|..|.:||:...||||||:.|:||..:|.|||.|||..|...|..|    .|||||||
Zfish   361 AAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWM 425

  Fly   189 APEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKND-WSDA 252
            ||||:   ....|..|||:|||||..||:.|.:|||.|.|.:.|||.||.|.:|.|...: .|..
Zfish   426 APEVV---TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPI 487

  Fly   253 FCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVR 301
            |..|:..||:....:|..|.:||.|.::...:..:.|..||...|.|::
Zfish   488 FRDFLGRCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKDAMK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 104/262 (40%)
S_TKc 27..280 CDD:214567 103/258 (40%)
pak2bNP_001020627.1 PBD 74..129 CDD:279166
STKc_PAK2 244..539 CDD:132986 115/301 (38%)
S_TKc 264..515 CDD:214567 103/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.