DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and lic

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_477162.1 Gene:lic / 32257 FlyBaseID:FBgn0261524 Length:334 Species:Drosophila melanogaster


Alignment Length:281 Identity:89/281 - (31%)
Similarity:142/281 - (50%) Gaps:17/281 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKG 92
            |.:.::|.|::|.|...|...|..::|:|::..| ...:|:.:.::.....:|..:.|.|:.:.|
  Fly    47 EKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMT-VNIREQHRLVMDLDISMRSSDCPYTVHFYG 110

  Fly    93 CYLRESTAWLVMEYCVGSASDI---IEVHKKPLHEDEIAAICLGVLSGLSYLHS-LGRIHRDIKA 153
            ...||...|:.||....|....   :.:|...:.|..:..|.:.|:|.|.|||: |..||||:|.
  Fly   111 AMYREGDVWICMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKP 175

  Fly   154 GNILLTDNGVVKLADFGSAAIKCPANSFVGT------PYWMAPEVILAM-DEGQYDGKVDVWSLG 211
            .|||:...|.||:.|||.:...  .:|...|      || ||||.|... :..|||.:.||||||
  Fly   176 SNILINRAGQVKICDFGISGYL--VDSIAKTIDAGCKPY-MAPERIDPQGNPAQYDIRSDVWSLG 237

  Fly   212 ITCIELAERKPPYFNMNA-MSALYHIAQNESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLL 275
            |..||:|..:.||.|... ...|..:.::..|.||:..:|..|..|:.:||:|....||:..:||
  Fly   238 IGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQLL 302

  Fly   276 THAYVTRP-RSDTVLLELIAR 295
            .|:::... :.:|.:.|.:||
  Fly   303 KHSFIVEHLQRNTDISEFVAR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 85/265 (32%)
S_TKc 27..280 CDD:214567 85/263 (32%)
licNP_477162.1 PKc_MKK3_6 44..326 CDD:173729 89/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.