DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Plk5

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_006240983.1 Gene:Plk5 / 314627 RGDID:1305038 Length:614 Species:Rattus norvegicus


Alignment Length:505 Identity:114/505 - (22%)
Similarity:187/505 - (37%) Gaps:74/505 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKDPEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDIL 73
            |:||         ...:::...:.||.|:|...|......|..:.|:|.:...|.........:.
  Rat    18 LRDP---------GSGRVYRRGKLIGKGAFSRCYKLTDMSTSAVFALKVVPRGGAGRLRLRGKVE 73

  Fly    74 KEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAICLGVLSG 137
            :||....:|:|.|.:.:...:......::|:|||. .|.:.:::| ::.|.|.|:.....|::||
  Rat    74 REIALHSRLHHRNIVAFHAHFADRDHVYMVLEYCSRQSLAHVLKV-RRTLTEPEVRYYFRGLVSG 137

  Fly   138 LSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANS----FVGTPYWMAPEVILAMDE 198
            |.|||....:|||:|..|..|..|..||:.|.|.||...||..    ..|||.:.||||:   ..
  Rat   138 LRYLHQQRIVHRDLKPSNFFLNKNMEVKIGDLGLAARVGPAGRCHRVLCGTPNFQAPEVV---SR 199

  Fly   199 GQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQN--ESPTLPKNDWSDAFCSFVELCL 261
            ..:..|.|:|:||.....:....||:    |.:.|..:.||  :...|.....|.:..|.:...|
  Rat   200 NGHSAKSDIWALGCIMYTVLTGTPPF----AAAPLSEMYQNIRDGHYLEPTQLSPSARSLIARLL 260

  Fly   262 KKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVR---ELDNLNYRKMKKILMVD----- 318
            ...|.||||...||...:.::..:...|......:.....   .|..| :||:.::|:..     
  Rat   261 APDPDERPSLDHLLQDDFFSQGFTPERLPPHSCHSPPVFAFPPPLGRL-FRKVGQLLLTQCRPPC 324

  Fly   319 --TCETESAVGDTDDQQDDHAGGDSSKSNSITSEHSIHSVGVSAASSQSSSSNSIPAAAQN---- 377
              |.:..|..|: :..:.||....:.:...:.:|..||.:.:....:.       ||.|:.    
  Rat   325 PFTSKEASGPGE-ESTEPDHMEASNEEGAPLCTESRIHLLTLGTPRTD-------PADAKGTLAL 381

  Fly   378 HHHIAAHH-----------HQQAASAAVAAAMHHHHHPHQQPP---------PSWPS-------G 415
            ...:|...           ..........||........|.||         |.|..       |
  Rat   382 QLEVATRKLCLCLDAGPVGRTATPKCRTEAAWRGPKPAGQDPPGEQRSVLWAPKWVDYSLKYGFG 446

  Fly   416 QQGQPVPPGAVSRNSSRHRNRPPLPNIMHSMNNNVTPTNSASVVPAPAPA 465
            .|......|.:.|:.|....|||..::.:..:.......:...||.|..|
  Rat   447 YQLSDGGSGVLFRDGSHMALRPPGGHVSYQPDQGTLWIFALRDVPGPLRA 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 74/263 (28%)
S_TKc 27..280 CDD:214567 74/259 (29%)
Plk5XP_006240983.1 STKc_PLK 25..279 CDD:271001 74/261 (28%)
S_TKc 27..279 CDD:214567 74/259 (29%)
POLO_box_1 429..516 CDD:240561 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.