DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Map3k20

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_038962299.1 Gene:Map3k20 / 311743 RGDID:1561394 Length:802 Species:Rattus norvegicus


Alignment Length:316 Identity:86/316 - (27%)
Similarity:147/316 - (46%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FEDLR---EIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTI 88
            |:||:   ..|.||||:||.|:.....:.||:||:           ..|.||...|..|:|.|.|
  Rat    13 FDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKL-----------LKIEKEAEILSVLSHRNVI 66

  Fly    89 EYKGCYLRESTAWLVMEYC-VGSASDIIEVHK-KPLHEDEIAAICLGVLSGLSYLH---SLGRIH 148
            ::.|..|......:|.||. :||..|.|..:: :.:..:.|......|..|:.|||   .:..||
  Rat    67 QFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMEHIMTWATDVAKGMHYLHMEAPVKVIH 131

  Fly   149 RDIKAGNILLTDNGVVKLADFGSAAIKCPAN--SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLG 211
            ||:|:.|:::..:||:|:.|||::.......  |.|||..|||||||.::...:   ..|.:|.|
  Rat   132 RDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSE---TCDTYSYG 193

  Fly   212 ITCIELAERKPPYFNMNAMSALYHIAQ-NESPTLPKNDWSDAFC--SFVEL---CLKKMPAERPS 270
            :...|:..|:.|:..:..:...:.:.: ||..|:|.:      |  ||.||   |.:....:|||
  Rat   194 VVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSS------CPRSFAELLHQCWEADAKKRPS 252

  Fly   271 SAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLNYRKMKKILMVDTCETESAV 326
            ..::::            :||.::...:...:.::..:.|.:.     .||.|:.:
  Rat   253 FKQIIS------------ILESMSNDTNLPDQCNSFLHNKAEW-----RCEIEATL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 80/270 (30%)
S_TKc 27..280 CDD:214567 80/268 (30%)
Map3k20XP_038962299.1 STKc_MLTK 22..263 CDD:270962 79/272 (29%)
SAM_MLTK 338..408 CDD:188928
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.