DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and gsk3ba

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_009302769.1 Gene:gsk3ba / 30654 ZFINID:ZDB-GENE-990714-4 Length:425 Species:Danio rerio


Alignment Length:417 Identity:102/417 - (24%)
Similarity:176/417 - (42%) Gaps:81/417 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ARPGSLKDPEIADLFNKHDPEKI-FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQE 67
            |.||...|          .|::: :.|.:.||:||||.||.|:...:.|:|||||:     ...:
Zfish    42 ATPGQGPD----------RPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKV-----LQDK 91

  Fly    68 KWQDILKEIRFLRQLNHPNTIEYK-----------GCYLRESTAWLVMEYCVGSASDIIEVH--- 118
            ::::  :|::.:|:|:|.|.:..:           ..||.     ||::|...:...:...:   
Zfish    92 RFKN--RELQIMRKLDHCNIVRLRYFFYSSGDKKDEVYLN-----LVLDYVPETVYRVARHYSRA 149

  Fly   119 KKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILL-TDNGVVKLADFGSA--AIKCPAN- 179
            |:.|....:......:...|:|:||.|..|||||..|:|| .|..|:||.|||||  .::...| 
Zfish   150 KQTLPMVYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNV 214

  Fly   180 SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQ-NESPT 243
            |::.:.|:.|||:|....:  |...:||||.|....||...:|.:...:.:..|..|.: ..:||
Zfish   215 SYICSRYYRAPELIFGATD--YTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPT 277

  Fly   244 LPK-NDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVRELDNLN 307
            ..: .:.:..:..|....:|..|..:.|.       .|.|||:....:.|.:|.         |.
Zfish   278 REQIREMNPNYTEFKFPQIKAHPWTKVSK-------QVFRPRTPPEAIALCSRL---------LE 326

  Fly   308 YRKMKKILMVDTCETESAVGDTDDQQDDHAGGDSSKSNSITSEHSIHSVGVSAASSQSSSSNS-- 370
            |....::..::.|.              |:..|..:..::...:......:...::|..|||.  
Zfish   327 YTPTARLTPLEACA--------------HSFFDELREPNVKLPNGREKPSLFNFTTQELSSNPTL 377

  Fly   371 ----IPAAAQNHHHIAAHHHQQAASAA 393
                |||.|:|....:...:..|.|.|
Zfish   378 ASILIPAHARNQAGASTPTNPSATSDA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 75/277 (27%)
S_TKc 27..280 CDD:214567 74/272 (27%)
gsk3baXP_009302769.1 STKc_GSK3 51..347 CDD:271039 86/339 (25%)
Pkinase 56..344 CDD:278497 84/331 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.