DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and pak2a

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001002717.1 Gene:pak2a / 266749 ZFINID:ZDB-GENE-021011-2 Length:517 Species:Danio rerio


Alignment Length:305 Identity:115/305 - (37%)
Similarity:166/305 - (54%) Gaps:18/305 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GSLKDPEIAD----LFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQE 67
            |.:.|.||.:    :.:..||:|.:....:||.|:.|.||.|....|.:.||||:::.   |.|.
Zfish   218 GKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVYTAIDVATGQEVAIKQINL---QKQP 279

  Fly    68 KWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCV-GSASDIIEVHKKPLHEDEIAAIC 131
            |.:.|:.||..:::|.:||.:.:...:|.....::||||.. ||.:|:  |.:..:.|.:|||:|
Zfish   280 KKELIINEILVMKELKNPNIVNFLDSFLVGDELFVVMEYLAGGSLTDV--VTETCMDEAQIAAVC 342

  Fly   132 LGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCPANS----FVGTPYWMAPEV 192
            ...|..|.:||:...||||||:.|:||..:|.|||.|||..|...|..|    .|||||||||||
Zfish   343 RECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV 407

  Fly   193 ILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLPKND-WSDAFCSF 256
            :   ....|..|||:|||||..||:.|.:|||.|.|.:.|||.||.|.:|.|...: .|..|..|
Zfish   408 V---TRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDF 469

  Fly   257 VELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTKSAVR 301
            :..||:....:|....:||.|.::...:..:.|..||...|.|::
Zfish   470 LNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMK 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 104/262 (40%)
S_TKc 27..280 CDD:214567 103/258 (40%)
pak2aNP_001002717.1 PBD 74..129 CDD:279166
STKc_PAK2 222..517 CDD:132986 114/301 (38%)
S_TKc 242..493 CDD:214567 103/258 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.