DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and Stk38l

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_006507092.1 Gene:Stk38l / 232533 MGIID:1922250 Length:477 Species:Mus musculus


Alignment Length:289 Identity:75/289 - (25%)
Similarity:111/289 - (38%) Gaps:67/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYK 91
            ||.|:.||.|:||.|...:...|..|.|:|.:.......:|:...|..|...|.:.:....::..
Mouse    96 FESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMF 160

  Fly    92 GCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNI 156
            ..:..:...:|:||:..|.....:.:.|..|.|:|........:..:..:|.||.||||:|..|:
Mouse   161 YSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDVKPDNL 225

  Fly   157 LLTDNGVVKLADFG-SAAIK-------------CPANSF-------------------------V 182
            ||...|.|||:||| ...:|             .|.:.|                         |
Mouse   226 LLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTV 290

  Fly   183 GTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESP--TLP 245
            |||.::||||.  |..| |:...|.||||:...|:....||:.             :|:|  |..
Mouse   291 GTPDYIAPEVF--MQTG-YNKLCDWWSLGVIMYEMLIGFPPFC-------------SETPQETYR 339

  Fly   246 K-NDWSDAFCSFVELCLKKMPAERPSSAK 273
            | ..|.:...         .|.|.|.|.|
Mouse   340 KVMSWKETLA---------FPPEVPVSEK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 75/289 (26%)
S_TKc 27..280 CDD:214567 75/289 (26%)
Stk38lXP_006507092.1 STKc_NDR2 93..465 CDD:270776 75/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.