DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and T08D2.7

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_508060.1 Gene:T08D2.7 / 191613 WormBaseID:WBGene00011612 Length:469 Species:Caenorhabditis elegans


Alignment Length:291 Identity:82/291 - (28%)
Similarity:137/291 - (47%) Gaps:39/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIADLFNKHDPEKIFEDLRE----IGHGSFGAVYYARCNLTREIVAIKKMS--YTGKQSQ--EKW 69
            |.||  :.|.||::......    :|.|.||.|........|.:||||:::  ::.:.|:  .|.
 Worm   153 ERAD--DNHHPEELTNKYHVTSHLLGKGGFGKVLLGYKKSDRSVVAIKQLNTQFSTRCSRAIAKT 215

  Fly    70 QDILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSA--SDIIE--VHKKPLHEDEIAAI 130
            :||..|:..:::|:|||.:....|......:::|:||..|..  |.:::  .::..|.|......
 Worm   216 RDIQNEVEVMKKLSHPNIVAIYDCITVAKYSYMVIEYVGGGEFFSKLVDSKYNQMGLGESLGKYF 280

  Fly   131 CLGVLSGLSYLHSLGRIHRDIKAGNILLTDNG---VVKLADFGSAAIKCPAN---SFVGTPYWMA 189
            ...::..:.||||:|..|||||..|||.::..   ::||.|||.|  |...|   :..|||.:.|
 Worm   281 AFQLIDAVLYLHSVGICHRDIKPENILCSNKAERCILKLTDFGMA--KNSVNRMKTHCGTPSYCA 343

  Fly   190 PEVILAMDEG-QYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESPTLP-----KND 248
            ||::  .::| :|..|||:||||..........||:      |..|...:.:...|.     ...
 Worm   344 PEIV--ANQGVEYTPKVDIWSLGCVLFITFSGYPPF------SEEYTDLKMDEQVLTGRLFFHEQ 400

  Fly   249 W---SDAFCSFVELCLKKMPAERPSSAKLLT 276
            |   :|...:.::..|...|..|||:.:|::
 Worm   401 WHRITDETQNMIQWMLTVEPLIRPSAVELMS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 76/279 (27%)
S_TKc 27..280 CDD:214567 76/277 (27%)
T08D2.7NP_508060.1 PKc_like 161..435 CDD:304357 78/281 (28%)
S_TKc 174..435 CDD:214567 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.