DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AgaP_AGAP007805

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_317699.4 Gene:AgaP_AGAP007805 / 1278155 VectorBaseID:AGAP007805 Length:319 Species:Anopheles gambiae


Alignment Length:295 Identity:78/295 - (26%)
Similarity:122/295 - (41%) Gaps:63/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTA 100
            |:.|.|:.|:...||:.||:||......::...:  ::.|.:.||:.:|||.:.|...::.....
Mosquito    20 GNLGTVFLAQHLPTRQHVAVKKFLVEDLKNDISY--VMDEAKHLREFDHPNILCYHTAFVHHLDL 82

  Fly   101 WLVME-YCVGSASD-IIEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGV 163
            :.|:. .|.||..| :....:....|..:..|...:|.||.|||..|.|||.|:|.::.|.:...
Mosquito    83 YFVLPLMCYGSCRDTMANYFETGFPEPILVCILRDILQGLVYLHWKGYIHRSIRASHVFLNETRA 147

  Fly   164 VKLADFGSAAIKCPANSFVG-----------TPY------WMAPEVILAMDEGQYDGKVDVWSLG 211
            |    .|...:   ..||:|           .|:      |:|||| ||.:...|..|.||:||.
Mosquito   148 V----LGGFRV---CTSFLGEGKRIRNLHELPPHSVKSLNWLAPEV-LAQNLTGYTEKSDVYSLA 204

  Fly   212 ITCIELAERKPPYFNMNA-------MSALYHIAQNESPTLPKND--------------------- 248
            ||..|||....|:.|:..       |...|.....::.|:|..:                     
Mosquito   205 ITVYELANGLEPFSNITTTLMLTEKMKGGYLPMLLDASTIPSEEVVLAQSAEAKSNEAAAASMRQ 269

  Fly   249 ------WSDAFCSFVELCLKKMPAERPSSAKLLTH 277
                  ::||...|.|.|.:..|..|||::.|.:|
Mosquito   270 IYASRQFTDALHKFAEQCSESDPKNRPSASALTSH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 78/295 (26%)
S_TKc 27..280 CDD:214567 78/295 (26%)
AgaP_AGAP007805XP_317699.4 S_TKc 9..307 CDD:214567 78/295 (26%)
PKc_like 11..319 CDD:304357 78/295 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.