DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AgaP_AGAP003040

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_311835.5 Gene:AgaP_AGAP003040 / 1272910 VectorBaseID:AGAP003040 Length:863 Species:Anopheles gambiae


Alignment Length:364 Identity:93/364 - (25%)
Similarity:155/364 - (42%) Gaps:81/364 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSAR-------PGSLKDPEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMS 59
            |::|       || :|.....|.:|.         :.|:|.|:|..........|::..|:|.: 
Mosquito   506 PASRSPFSNEIPG-VKPVAFGDEYNL---------MEELGRGTFSICRMCEHRTTKKHYAVKII- 559

  Fly    60 YTGKQSQEKWQDILKEIR-FLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGS--ASDIIEVHKKP 121
                  .:.:.|..:|:. .||..||||.:...|.:...|..:||||...|.  ...|:.:|.  
Mosquito   560 ------DKSYHDCREEVEILLRYGNHPNIVTLYGVHEDASYVYLVMELLKGGELLDRILAIHF-- 616

  Fly   122 LHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNG----VVKLADFGSAAIKCPANSFV 182
            :.|.|.:|:...|:|.::|||..|.:|||:|..|:|.....    .:||.|.|.|......|..:
Mosquito   617 MAEQEASAVLRTVVSAVAYLHEHGVVHRDLKPSNLLYASVNHTPESLKLCDLGFAKQLRADNGLL 681

  Fly   183 GTPYW----MAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQNESP- 242
            .||.:    :||||:  ..:| ||...|:||||:....:.:.|.|:.:          ..|:|| 
Mosquito   682 MTPCYTANFVAPEVL--KKQG-YDLACDIWSLGVLLYIMLDGKTPFAS----------TPNDSPD 733

  Fly   243 -----------TLPKNDW---SDAFCSFVELCLKKMPAERPSSAKLLTHAYVTR--PRSDTVLLE 291
                       .|....|   ||.....:...|..:|:.||::|::|.|.:::|  ||    |:.
Mosquito   734 MILARIGSGKVDLETGKWPTISDEVKDLLRQMLHIVPSRRPTAAQILRHPWLSRSGPR----LMY 794

  Fly   292 LIARTKSAVRELDNLNYRKMKKILMVDTCETESAVGDTD 330
            ....|:.|..|          :.::|:..:|:.|..:|:
Mosquito   795 NTVGTQHATSE----------RPMVVEPQDTKPACVNTE 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 75/282 (27%)
S_TKc 27..280 CDD:214567 75/278 (27%)
AgaP_AGAP003040XP_311835.5 S_TKc 165..423 CDD:214567
STKc_RSK_N 169..483 CDD:270734
STKc_RSK_C 527..837 CDD:270993 87/342 (25%)
S_TKc 528..785 CDD:214567 76/287 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.