DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and AgaP_AGAP000043

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_311117.5 Gene:AgaP_AGAP000043 / 1272234 VectorBaseID:AGAP000043 Length:1379 Species:Anopheles gambiae


Alignment Length:423 Identity:96/423 - (22%)
Similarity:156/423 - (36%) Gaps:130/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FNKHDPEKIFED----LREIGHGSFGAVY---------YARC---NLTREIVAIKKMSYTGKQSQ 66
            ||.|   .:..|    |..:|.|.|..|:         |..|   .|.::....||.:|.     
Mosquito  1015 FNNH---PVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLNKDWKEDKKANYI----- 1071

  Fly    67 EKWQDILKEIRFLRQLNHPNTIEYKGCYLRESTAW-LVMEYCVGSASDIIEVHKKPLHEDEIAAI 130
               :..|:|....:.|:||..::....:..::.:: .|:|||.|...|......|.:.|.|..:|
Mosquito  1072 ---KHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEKEARSI 1133

  Fly   131 CLGVLSGLSYLHSLGR--IHRDIKAGNILLTDN---GVVKLADFGSAAIKCPAN----------- 179
            .:.|:|.|.||:.:..  ||.|:|.||||||:.   |.:|:.|||.:.:....|           
Mosquito  1134 IMQVVSALKYLNEIKPPIIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDEENYNPDHGMDLTS 1198

  Fly   180 SFVGTPYWMAPE-VILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQN---- 239
            ...||.:::.|| .::..:..:...||||||:|:...:....|.|:.:..:.:.:  :.:|    
Mosquito  1199 QGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATI--LEENTILK 1261

  Fly   240 -------ESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTVLLELIARTK 297
                   ..||:     |:...||:..||.....:|.....|..|.|:..|.|            
Mosquito  1262 ATEVQFANKPTV-----SNEAKSFIRGCLAYRKEDRMDVFALAKHEYLQPPVS------------ 1309

  Fly   298 SAVRELDNLNYRKMKKILMVDTCETESAVGDTDDQQDDHAGGDSSKS------------------ 344
                        |..:               :.:.|:.||||.:|.|                  
Mosquito  1310 ------------KHNR---------------SSNAQNAHAGGQNSSSTGTGAGGGGGGGGGGGGG 1347

  Fly   345 ---------NSITSEHSIHSVGVSAASSQSSSS 368
                     |.|..:.|. |.|:....:|||||
Mosquito  1348 SGGSGGAGGNQIGQQTSF-STGMFGNMNQSSSS 1379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 73/301 (24%)
S_TKc 27..280 CDD:214567 72/297 (24%)
AgaP_AGAP000043XP_311117.5 S_TKc 1036..1304 CDD:214567 68/282 (24%)
STKc_TLK 1036..1303 CDD:270892 68/281 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.