Sequence 1: | NP_001188672.1 | Gene: | Tao / 32948 | FlyBaseID: | FBgn0031030 | Length: | 1039 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012811721.1 | Gene: | lats2 / 100124721 | XenbaseID: | XB-GENE-994907 | Length: | 1117 | Species: | Xenopus tropicalis |
Alignment Length: | 262 | Identity: | 62/262 - (23%) |
---|---|---|---|
Similarity: | 106/262 - (40%) | Gaps: | 66/262 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 EKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTI 88
Fly 89 EYKGCYLRESTAWLVMEYCVGSASDI------IEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRI 147
Fly 148 HRDIKAGNILLTDNGVVKLADFGSAA--------------------------------------- 173
Fly 174 ------------IKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFN 226
Fly 227 MN 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tao | NP_001188672.1 | STKc_TAO | 25..282 | CDD:270784 | 62/261 (24%) |
S_TKc | 27..280 | CDD:214567 | 62/259 (24%) | ||
lats2 | XP_012811721.1 | UBA_LATS2 | 102..142 | CDD:270581 | |
PKc_like | 696..1075 | CDD:419665 | 62/261 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |