DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and lats2

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:XP_012811721.1 Gene:lats2 / 100124721 XenbaseID:XB-GENE-994907 Length:1117 Species:Xenopus tropicalis


Alignment Length:262 Identity:62/262 - (23%)
Similarity:106/262 - (40%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQDILKEIRFLRQLNHPNTI 88
            :.:|..::.:|.|:||.|..|....|:.:.|:|.:......::.:...:..|...|.:.::...:
 Frog   695 KSLFVKIKTLGIGAFGEVCLASKVDTKALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVV 759

  Fly    89 EYKGCYLRESTAWLVMEYCVGSASDI------IEVHKKPLHEDEIAAICLGVLSGLSYLHSLGRI 147
            :....:..:.:.:.||:|..|  .|:      :||..:.|....||.:.|.:.|    :|.:|.|
 Frog   760 KLYYSFQDKDSLYFVMDYIPG--GDMMSLLIRMEVFPEHLARFYIAELTLAIES----VHKMGFI 818

  Fly   148 HRDIKAGNILLTDNGVVKLADFGSAA--------------------------------------- 173
            |||||..|||:..:|.:||.|||...                                       
 Frog   819 HRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHARQDSMEPSELWDDVSNCRCGDR 883

  Fly   174 ------------IKCPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFN 226
                        .:|.|:|.||||.::||||:|...   |....|.||:|:...|:...:||:..
 Frog   884 LKTLEQRAKRQHHRCLAHSLVGTPNYIAPEVLLRKG---YTQLCDWWSVGVILFEMLVGQPPFLA 945

  Fly   227 MN 228
            .|
 Frog   946 SN 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 62/261 (24%)
S_TKc 27..280 CDD:214567 62/259 (24%)
lats2XP_012811721.1 UBA_LATS2 102..142 CDD:270581
PKc_like 696..1075 CDD:419665 62/261 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.