DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tao and pkn1b

DIOPT Version :9

Sequence 1:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster
Sequence 2:NP_001082929.1 Gene:pkn1b / 100007897 ZFINID:ZDB-GENE-070424-87 Length:909 Species:Danio rerio


Alignment Length:278 Identity:74/278 - (26%)
Similarity:114/278 - (41%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSARPGSLKDPE-----IADLFNKHDPEK--IFEDLREI---GHGSFGAVYYARCNLTREIVAIK 56
            |.:.||. ..||     |:.|..:...:.  ..:|.|.|   |.|.||.|..:....:..:.|||
Zfish   548 PVSPPGP-APPERVVRSISHLSQRRSSKSALCLQDFRMIAVLGRGHFGKVLLSEYRRSGNLYAIK 611

  Fly    57 KMSYTGKQSQEKWQDILKEIRFLRQLN---HPNTIEYKGCYLRESTAWLVMEYCVGSASDI-IEV 117
            .:......::::.:.::.|.|....:|   ||..:....|:........||||..|  .|: :.:
Zfish   612 ALKKGDIVARDEVESLMCEKRIFETVNSAQHPFLVNLFACFQTPEHVCFVMEYTAG--GDLMMHI 674

  Fly   118 HKKPLHEDEIAAICLGVLSGLSYLHSLGRIHRDIKAGNILLTDNGVVKLADFGSAAIKCP----- 177
            |.....|.........|:.||.:||....::||:|..|:||...|.||:||||    .|.     
Zfish   675 HADVFSETRSVFYSACVVLGLQFLHDNKIVYRDLKLDNLLLDTEGYVKIADFG----LCKEGMGH 735

  Fly   178 ---ANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPYFNMNAMSALYHIAQN 239
               .::|.|||.::||||   :.:..|...||.|.||:                   .:|.:...
Zfish   736 GDRTSTFCGTPEFLAPEV---LTDTSYTRAVDWWGLGV-------------------LIYEMMVG 778

  Fly   240 ESPTLPKNDWSDAFCSFV 257
            ||| .|.:|..:.|.|.|
Zfish   779 ESP-FPGDDEEEVFDSIV 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 67/250 (27%)
S_TKc 27..280 CDD:214567 67/246 (27%)
pkn1bNP_001082929.1 HR1_PKN_1 15..80 CDD:212012
HR1_PKN1_2 99..176 CDD:212020
HR1_PKN1_3 180..253 CDD:212026
C2 364..447 CDD:301316
STKc_PKN 582..907 CDD:270741 66/243 (27%)
S_TKc 582..841 CDD:214567 66/243 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.