DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment car and AT4G36100

DIOPT Version :9

Sequence 1:NP_001259707.1 Gene:car / 32947 FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_567996.1 Gene:AT4G36100 / 829766 AraportID:AT4G36100 Length:236 Species:Arabidopsis thaliana


Alignment Length:233 Identity:48/233 - (20%)
Similarity:79/233 - (33%) Gaps:86/233 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LQRLYGRIPKI---YGKGEFAHRVWEHAKQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQ 244
            :..|:|.|..:   |.:.:.||..:        |...:...||.|:.:|..|..           
plant    16 ISNLFGNISSLKSAYIELQSAHTPY--------DPEKIQAADKVVISELKNLSE----------- 61

  Fly   245 LTYEGLIDEFYGIRQNKLTLPAENFPSDGALPGGGGSGPRVEESQSLLG---------------- 293
                  :..||  |:|. ..|....|.|..|      ...::|.||||.                
plant    62 ------MKHFY--RENN-PKPVCVSPQDSRL------AAEIQEQQSLLKTYEVMVKRSLMEQSLD 111

  Fly   294 --DTEKKTILLHSGE----QLYAELRNKHFN-----------------EVTKLLARKA--REIHV 333
              |.::|.:::..|.    :|.:.|:.|..|                 ..|::.|.:|  ||..:
plant   112 AYDEKEKEMMMMIGSINRTELLSVLKAKGTNIDKLRFAIMYLISLESVNQTEVEAVEAALREAKI 176

  Fly   334 QMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAI 371
            .   ||..:.|::|||     |...:|...|:..|.|:
plant   177 D---TSTFQYVKKIKS-----LNVSLAANSASKSHIAL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
carNP_001259707.1 Sec1 36..606 CDD:279352 48/233 (21%)
AT4G36100NP_567996.1 DUF641 7..>103 CDD:282685 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.