DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment car and STXBP3

DIOPT Version :9

Sequence 1:NP_001259707.1 Gene:car / 32947 FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_009200.2 Gene:STXBP3 / 6814 HGNCID:11446 Length:592 Species:Homo sapiens


Alignment Length:652 Identity:114/652 - (17%)
Similarity:230/652 - (35%) Gaps:174/652 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EGS-KVIVLDETMIGPLDLVTRPKLFADRGIRLLALKPELHLPREVANVVYVMRPRV----ALME 92
            ||. |:::|||.....|....:.....:.||.::....:...|......:|.:.|..    ..:.
Human    29 EGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYFITPTSKSVDCFLH 93

  Fly    93 QLAAHVKAGGRAAAGRQYHILFAP-------RRSCLCVSQLEVSGVLGSFGNIEELAWNYLPLDV 150
            ..|:  |:..:..|...|...|.|       :.||           ..|....:|:..:::|.:.
Human    94 DFAS--KSENKYKAAYIYFTDFCPDNLFNKIKASC-----------SKSIRRCKEINISFIPHES 145

  Fly   151 DLVSMEMPNAF------RDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKIYGKGEFAHRVWEHAKQ 209
            .:.::::|:||      ...:..|..:.:...|..:|.:.......|.:    .:..:..::|.:
Human   146 QVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGV----RYKSKPLDNASK 206

  Fly   210 LGR------------DERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEGLIDEFYGIRQNKL 262
            |.:            ||::|..|.  ...||:::||..|.:|.:..:||::.:..:.        
Human   207 LAQLVEKKLEDYYKIDEKSLIKGK--THSQLLIIDRGFDPVSTVLHELTFQAMAYDL-------- 261

  Fly   263 TLPAEN----FPSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKL 323
             ||.||    :.:||                      ::|..:|...:.|:..:|::|...|.:.
Human   262 -LPIENDTYKYKTDG----------------------KEKEAILEEEDDLWVRIRHRHIAVVLEE 303

  Fly   324 LARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQ----KKATSEHTAIAGLLHEQVNAVRF 384
            :.:..:||.....||....|:        :.|.|||.:    :|..::......|..:.:|..:.
Human   304 IPKLMKEISSTKKATEGKTSL--------SALTQLMKKMPHFRKQITKQVVHLNLAEDCMNKFKL 360

  Fly   385 ADDLAAEQEFMVCADIDKPSAYIED--LIACRVELNR------VLRLICMQCHAASGFKEKLLNH 441
            ..:...:.|..:....|.....::|  .:...|.||:      .:|.|.:...:.:|..|:.|:.
Human   361 NIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTEENLDR 425

  Fly   442 YKRELVHVYGLEVLLTISNLEKSGLLHLQTESRAYSVLRKTLHLTVDDNVEIEP---------KD 497
                           .|.|::      ::.||   .::|...:|    .|.|.|         ||
Human   426 ---------------LIQNVK------IENES---DMIRNWSYL----GVPIVPQSQQGKPLRKD 462

  Fly   498 ISYVHSF----YAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSE 558
            .|...:|    :.|....|:|        ..:.:::::...|......|...|.|.         
Human   463 RSAEETFQLSRWTPFIKDIME--------DAIDNRLDSKEWPYCSQCPAVWNGSGA--------- 510

  Fly   559 GSLLNVPRV-----------VLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLD 612
            .|....||.           ::|..:||.|::|:.. .:..:|...:.|.:|.:|.|:.....||
Human   511 VSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRC-AYEVSQAHKSCEVIIGSTHVLTPKKLLD 574

  Fly   613 SL 614
            .:
Human   575 DI 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
carNP_001259707.1 Sec1 36..606 CDD:279352 110/638 (17%)
STXBP3NP_009200.2 Mediates interaction with DOC2B. /evidence=ECO:0000250 1..255 44/244 (18%)
Sec1 33..569 CDD:307231 110/639 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.