DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment car and abo.1

DIOPT Version :9

Sequence 1:NP_001259707.1 Gene:car / 32947 FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster
Sequence 2:XP_012823948.1 Gene:abo.1 / 550054 XenbaseID:XB-GENE-5721534 Length:354 Species:Xenopus tropicalis


Alignment Length:123 Identity:30/123 - (24%)
Similarity:50/123 - (40%) Gaps:28/123 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 VDQLILLDRSIDLLSPLATQL---TYEGLIDEFYGIRQNKLTLPAENFP-SDGALP--------G 277
            ||.|:.:|..:.....:..::   .:..|...|||..:...|.  |..| |...:|        .
 Frog   206 VDYLVCVDVDMQFSDEVGVEILSDVFGTLHPGFYGSDRQSFTY--ERRPESQAFIPADEGDFYYA 268

  Fly   278 GGGSGPRVEESQSLLG------DTEKKTILLHSGEQLYAE--LRNKHF--NEVTKLLA 325
            ||..|..|||...|..      .|:|:    |:.|.::.:  ..||:|  ::.||:|:
 Frog   269 GGFFGGTVEEVYKLTDFCHYAMMTDKE----HNIEAIWHDESYLNKYFLYHKPTKILS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
carNP_001259707.1 Sec1 36..606 CDD:279352 30/123 (24%)
abo.1XP_012823948.1 Glyco_tranf_GTA_type 66..354 CDD:416254 30/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.