DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment car and rnf138

DIOPT Version :9

Sequence 1:NP_001259707.1 Gene:car / 32947 FlyBaseID:FBgn0000257 Length:639 Species:Drosophila melanogaster
Sequence 2:NP_001016429.2 Gene:rnf138 / 549183 XenbaseID:XB-GENE-1001373 Length:222 Species:Xenopus tropicalis


Alignment Length:187 Identity:35/187 - (18%)
Similarity:68/187 - (36%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 ALPGGGG-----SGPRVEESQSLLG-----DTEKKTIL---LHSGEQLYAELRNKHFNEVTKLLA 325
            |:..||.     .||..:..:|...     |.|.:.:|   ::.|:|:.......|:        
 Frog    45 AMKSGGAYCPLCRGPVSKSERSAPARASDIDLEMRMLLGGCMYCGKQVKLHYMKLHY-------- 101

  Fly   326 RKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVRFADDLAA 390
            :..|:...:...:.:|.::|:.:...:...|:...  ...||.......|.|..|.|.:..::  
 Frog   102 KSCRKYQEEYGLSPKDPTIQKDQKSTKCQDPKYKC--PLCSEQNLSQRSLLEHCNNVHYYQEV-- 162

  Fly   391 EQEFMVCADI--DKPSAYIEDLIACRVELNRVLRLICMQCH--AASGFKEKLLNHYK 443
            |....:||.:  ..|.....::||.....:|......|..|  ..:.|::.:.|.||
 Frog   163 EMVCPICATLPWGDPIQTTGNIIAHLNARHRFNYQEFMNIHLDEEAQFQKAIENSYK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
carNP_001259707.1 Sec1 36..606 CDD:279352 35/187 (19%)
rnf138NP_001016429.2 RING 17..60 CDD:238093 4/14 (29%)
zf-Di19 134..193 CDD:283297 12/62 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.