DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip84 and Grip75

DIOPT Version :10

Sequence 1:NP_728264.1 Gene:Grip84 / 32946 FlyBaseID:FBgn0026430 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_319589.5 Gene:Grip75 / 1279810 VectorBaseID:AGAMI1_014140 Length:695 Species:Anopheles gambiae


Alignment Length:102 Identity:20/102 - (19%)
Similarity:37/102 - (36%) Gaps:34/102 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 YVYSIISSNFPIENL-----FHL---TVFCVPLGELAVSDAIKIRDILLKSAHFEYGQIDVKENI 193
            |:||:....|....:     |||   .:|.:|.                     .:.::|..:.:
Mosquito   291 YLYSLPKDQFVALGMAMGIFFHLKYAVIFGLPT---------------------LFAKLDNMDPL 334

  Fly   194 PQEVVRVFVPEFNDEIPRYRSRGLEFKVDQFQLTFSF 230
            |..:..:.|..:: ::.|...|||.    ||..|:.|
Mosquito   335 PGPICLIRVTLYS-KVWREFDRGLY----QFFKTYIF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grip84NP_728264.1 GCP_N_terminal 276..569 CDD:465456
GCP_C_terminal 572..912 CDD:461187
Grip75XP_319589.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.