DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and YOX1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_013685.1 Gene:YOX1 / 854981 SGDID:S000004489 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:81/322 - (25%)
Similarity:138/322 - (42%) Gaps:67/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 NRLLSLASSVQDTRSPITTLEKSSSS----SLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHT 444
            ||..|:.|:::.|   :|:|.::||:    .|.|      |..| |||.|.|.:........|..
Yeast    54 NRPRSVESALRHT---VTSLHENSSAYGDDMLKH------TQSD-SALSSQLNSSQETVDESHEN 108

  Fly   445 PAHTP-PSRLSDHTISAEGAFKKLKPEPNSGLSTVSA--GITSPGSGLS-----SLSQHAGHT-- 499
            ...|| .|:..|:::|:    ||     |..|:.:||  .|..|.:...     :...|:..|  
Yeast   109 LLLTPLNSKKRDYSVSS----KK-----NDILTPLSAAKSIIIPSASKEKRRAFAFITHSQETFP 164

  Fly   500 ---PTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNR 561
               |...:.|...|:|.||  :.::|:.|:|.|.|...|....|.|||.:..:.|..:|:||||:
Yeast   165 KKEPKIDNAPLARRKRRRT--SSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNK 227

  Fly   562 RAKYRKQEKQLQKALAPSVIPSCNGMMRNIQGYSVSRGYQPYPHHNT--MNRYPQDLFQMG---- 620
            |...::|  ::..:.:.::|            .:||....|...|.|  .:|...|:.:.|    
Yeast   228 RQAVKRQ--RIATSKSTTII------------QTVSPPSPPLDVHATPLASRVKADILRDGSSCS 278

  Fly   621 --ASSYPGMTQPFSMAHSTNMGS--VGVRQDSMGEFHGMSPEDEWYNKSLSALRMNSSHHPN 678
              :||.|....|....||.|..|  ..:::.....|| ::|:    .|:|:.::.:.:...|
Yeast   279 RSSSSSPLENTPPRPHHSLNRRSSTPSIKRSQALTFH-LNPQ----KKTLTPVKTSPNSRVN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 19/52 (37%)
YOX1NP_013685.1 COG5576 126..267 CDD:227863 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.