DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and YHP1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_010739.3 Gene:YHP1 / 852062 SGDID:S000002859 Length:353 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:56/214 - (26%)
Similarity:84/214 - (39%) Gaps:52/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RLLSLASSVQDTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPAHTP 449
            ||..||:|....| |:..:.||.......:||   :|:            .:|..|...|.:.||
Yeast    42 RLPPLAASAHIVR-PVVNIYKSPCDEERPKRK---SPQ------------AVDFLSQRVTTSMTP 90

  Fly   450 ---PSRLSDHT--ISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTT------- 502
               |.:||.|:  ........|.:| |.|..|.....|.:|.|...::.     ||||       
Yeast    91 LSKPKKLSSHSPFTPTVRVCSKEQP-PQSMHSYKKVNILTPLSAAKAVL-----TPTTRKEKKRS 149

  Fly   503 --------ASCPTP---------ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLN 550
                    .:.|..         |||:.|.|.:.| |..|:.||.:...|:...|.||:....::
Yeast   150 FAFITHSQETFPKKEPKIDNARLARRKRRRTSSYE-LGILQTAFDECPTPNKAKRIELSEQCNMS 213

  Fly   551 EARIQVWFQNRRAKYRKQE 569
            |..:|:||||:|...:|.:
Yeast   214 EKSVQIWFQNKRQAAKKHK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 18/52 (35%)
YHP1NP_010739.3 COG5576 123..278 CDD:227863 30/116 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.