DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HB-1

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_174164.2 Gene:HB-1 / 839740 AraportID:AT1G28420 Length:1705 Species:Arabidopsis thaliana


Alignment Length:147 Identity:39/147 - (26%)
Similarity:65/147 - (44%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQK 574
            :|:.:|.|   ||..||..:::..||....|.||:....|::.::|:||.:||.| .|::.|..|
plant    42 KRQMKTPF---QLETLEKVYSEEKYPSEATRAELSEKLDLSDRQLQMWFCHRRLK-DKKDGQSNK 102

  Fly   575 ALAPSV----------IPSCNGMMRNIQGYSVS---RGYQPYPHH-------NTMNRYPQDLFQ- 618
            .:..||          :|:..|.:......|.|   .|..||.:.       ::.:|...|.:: 
plant   103 PVKSSVAAVQSASVNELPAAAGSVPEQDSRSDSGSESGCSPYSNSRRNFASGSSSSRAELDEYET 167

  Fly   619 MGASSYPGMTQPFSMAH 635
            ||..||.....  :|.|
plant   168 MGKPSYESRLS--TMVH 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649 19/55 (35%)
HB-1NP_174164.2 Homeodomain 40..96 CDD:459649 19/57 (33%)
DDT 550..605 CDD:460696
HARE-HTH 731..799 CDD:461541
WHIM1 936..975 CDD:464774
WSD 1099..1173 CDD:464775
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.