DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and MIXL1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:162 Identity:58/162 - (35%)
Similarity:75/162 - (46%) Gaps:38/162 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 PAHTPPSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGL----------------SSLS 493
            ||:..|        .|.||   |.|.|:...:.:.|....||...                :||.
Human    18 PAYRAP--------HAGGA---LLPPPSPAAALLPAPPAGPGPATFAGFLGRDPGPAPPPPASLG 71

  Fly   494 QHAGHTPTTASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARI---- 554
            ..|  .|..|:.|:.::||.||:|:.|||..||..|.::.||||:.||.||..|.|.|:||    
Human    72 SPA--PPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQLLF 134

  Fly   555 ----QVWFQNRRAKYRKQE-KQLQKALAPSVI 581
                ||||||||||.|:|. |..|....|.:|
Human   135 SPLFQVWFQNRRAKSRRQSGKSFQPLARPEII 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 32/60 (53%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.