DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and HB52

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_200209.1 Gene:HB52 / 835481 AraportID:AT5G53980 Length:156 Species:Arabidopsis thaliana


Alignment Length:65 Identity:20/65 - (30%)
Similarity:38/65 - (58%) Gaps:4/65 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 RRHRTTFTQEQLAELEAAFA--KSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQ 573
            :..:...||:|:.:||..|.  |...||:  :.:|:....|.:.::.|||||:||:::.|..::|
plant     9 KNKKKRLTQDQVRQLEKCFTMNKKLEPDL--KLQLSNQLGLPQRQVAVWFQNKRARFKTQSLEVQ 71

  Fly   574  573
            plant    72  71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649 18/57 (32%)
HB52NP_200209.1 Homeodomain 11..64 CDD:459649 18/54 (33%)

Return to query results.
Submit another query.