DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Rhox13

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001171931.1 Gene:Rhox13 / 73614 MGIID:1920864 Length:232 Species:Mus musculus


Alignment Length:230 Identity:63/230 - (27%)
Similarity:92/230 - (40%) Gaps:71/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 GSHENRLLSLASSVQDTRSPI--TTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHH 442
            |:.|....::||| .|:...|  .|:::|.|.|   :.:..|..|..|:          |||...
Mouse    39 GAVEVAQAAVASS-HDSGGAIGCATVKESESDS---ESESDSESESDSS----------DSSDES 89

  Fly   443 HTPAHTPPSRLSDHTISAEGAFKKLKPEPNS--GLSTVSAGITSPGSGLSSLSQHAGHTPTTASC 505
            ...:.|.....||             ||..:  .::.|:|....|            ..|..|:.
Mouse    90 DDDSSTSDEDTSD-------------PEEAAAPSVAAVAAAAAPP------------TVPAAAAI 129

  Fly   506 PTP-----------ARRRHRTT---FTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQV 556
            ..|           .|||.|..   |.|.|:.|:|:.|.::.|||:..|.|||||..:.|.:::|
Mouse   130 QIPGPYRYRPPRRHVRRRRRGPPFHFAQWQVEEMESLFEETQYPDLLTRGELARTLNVPEVKVKV 194

  Fly   557 WFQNRRAKYRKQEKQLQKALAPSVIPSCNGMMRNI 591
            ||.|||||.||.|::              .|:|||
Mouse   195 WFTNRRAKQRKIERR--------------EMLRNI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 25/55 (45%)
Rhox13NP_001171931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..114 20/95 (21%)
Homeobox 155..204 CDD:278475 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.