DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Rhox13

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:XP_001077350.3 Gene:Rhox13 / 691244 RGDID:1586264 Length:234 Species:Rattus norvegicus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:93/262 - (35%) Gaps:103/262 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GGLLGLQQG-LLEDHASMQHGGVGQDTKF-----------------MSFQDQRLMGIGGSHENRL 386
            |.:...|.| ....|||  .|.:|.||.:                 .|:.|:......|..::  
  Rat    39 GAMAVAQAGAACRSHAS--RGTIGYDTVYEPNVKGDPKQESESDTEESYDDEDDDEDEGDEDD-- 99

  Fly   387 LSLASSVQDTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSGLPTPGMDSSSHHHTPAHTPPS 451
              |::|.|||..|                     .::.:||:               ..|..|| 
  Rat   100 --LSTSDQDTSDP---------------------EQEEAALF---------------VAAAAPP- 125

  Fly   452 RLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSPGSGLSSLSQHAGHTPTTASCPTPARRRHRTT 516
                                   ::..:|.|..||...|...:|               ||||.:
  Rat   126 -----------------------IAPAAAAIQIPGPHRSRRRRH---------------RRHRRS 152

  Fly   517 ----FTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALA 577
                |||.|:.|:|..|.::.|||:..|.|||||..:.|.:::|||.|||||.||.|::......
  Rat   153 SPYLFTQWQVEEMENLFEETPYPDVLTRGELARTLNVPEVKVKVWFSNRRAKQRKNERRAMLRNM 217

  Fly   578 PS 579
            ||
  Rat   218 PS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 27/56 (48%)
Rhox13XP_001077350.3 Homeobox 157..206 CDD:278475 25/48 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.