DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Rhox10

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001032670.1 Gene:Rhox10 / 652926 RGDID:1563291 Length:201 Species:Rattus norvegicus


Alignment Length:89 Identity:35/89 - (39%)
Similarity:53/89 - (59%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 TASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYR 566
            ||:|.:..|:.....||..||.|||.||.::.|||.:.|:.||....::|.:::.||:|:|||||
  Rat    84 TAACRSNNRQIKHHKFTYAQLCELEKAFQETQYPDAHRRKALAALIHVDECKVKAWFKNKRAKYR 148

  Fly   567 KQEKQLQKALAPSVIPSCNGMMRN 590
            |:.|:|..:.|.|      |.:.|
  Rat   149 KKHKELLLSSATS------GTLNN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 22/52 (42%)
Rhox10NP_001032670.1 Homeobox 99..148 CDD:278475 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.