powered by:
Protein Alignment CG32532 and hoxb6b
DIOPT Version :9
Sequence 1: | NP_608318.5 |
Gene: | CG32532 / 32943 |
FlyBaseID: | FBgn0052532 |
Length: | 688 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571613.1 |
Gene: | hoxb6b / 58053 |
ZFINID: | ZDB-GENE-000823-7 |
Length: | 224 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 29/75 - (38%) |
Similarity: | 41/75 - (54%) |
Gaps: | 3/75 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 504 SC---PTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKY 565
|| |....||.|.|:|:.|..|||..|..:.|.....|.|::....|.|.:|::||||||.|:
Zfish 138 SCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKW 202
Fly 566 RKQEKQLQKA 575
:|:.|.:..|
Zfish 203 KKENKAVNSA 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.