DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Drgx

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:187 Identity:64/187 - (34%)
Similarity:84/187 - (44%) Gaps:52/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEK---- 570
            :||:|||||.:||.|||.|||::||||::.||:||....|.|||:||||||||||:||.|:    
  Fly    52 QRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRRAKWRKAERLKDE 116

  Fly   571 -----------QLQKA--------------------LAP---SVIPSCNGMMRNIQGYSVSRGYQ 601
                       .|.|.                    |.|   |..|..||.|.....:|.|..:.
  Fly   117 QRKRENGESSSSLDKLHDSRESSPDITGEIDDDMDDLPPRQRSHSPLANGQMEQQHSHSHSHSHS 181

  Fly   602 PYP----H-HNTMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEFH 653
            ..|    | .::.|..|....|:.|:       |.|.:.|  :||:.....|....|
  Fly   182 RSPGGGMHLDSSDNERPLSSNQLTAT-------PHSASQS--LGSISAGSPSPSGMH 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 35/52 (67%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 35/51 (69%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.