DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and PROP1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_006252.4 Gene:PROP1 / 5626 HGNCID:9455 Length:226 Species:Homo sapiens


Alignment Length:216 Identity:72/216 - (33%)
Similarity:95/216 - (43%) Gaps:61/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 LKPE--PNSGLSTVSAGITSP--------GSGLSSLSQHAGHTPTTASCPTPARRRHRTTFTQEQ 521
            |.||  |.:|..|.:...::|        |.|.|..|...|......|     ||||||||:..|
Human    21 LLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQGGQRGRPHS-----RRRHRTTFSPVQ 80

  Fly   522 LAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALA-------PS 579
            |.:||:||.::.||||:.||.|||.|.|:||||||||||||||.||||:.|.:.||       .|
Human    81 LEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSPAAFSS 145

  Fly   580 VIPSCNGMMRNIQGYSVSRGYQP---YPHHNTMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGS 641
            .:|.....     .||.:....|   :||.          :.....|.|.....|:::|.:    
Human   146 FLPESTAC-----PYSYAAPPPPVTCFPHP----------YSHALPSQPSTGGAFALSHQS---- 191

  Fly   642 VGVRQDSMGEFHGMSPEDEWY 662
                             ::||
Human   192 -----------------EDWY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 36/52 (69%)
PROP1NP_006252.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 18/58 (31%)
Homeobox 72..126 CDD:395001 36/53 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..226 72/216 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9618
SonicParanoid 1 1.000 - - X5351
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.