DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Nobox

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001178942.1 Gene:Nobox / 502759 RGDID:1563929 Length:524 Species:Rattus norvegicus


Alignment Length:219 Identity:61/219 - (27%)
Similarity:81/219 - (36%) Gaps:76/219 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 SSVQDTRSPITTLEKSSSSSLNHQRKCSSTPEDFSALYSG-------LPTPGMDSSSHHHTPAHT 448
            ::.|||..|                     |:|.:.|..|       ||..|:         ...
  Rat    22 TAAQDTEGP---------------------PQDPAPLVQGDPDKLSSLPRAGL---------GKR 56

  Fly   449 PPSRLSDHTISAEGAFKKLKPEPNSGLSTVSAGITSP-----GSGLS---------SLSQHAGHT 499
            |.|:.|...|.|:.......|.|         .:.||     ||.|.         |:|...|..
  Rat    57 PLSKTSGDCIDADTCRVHTAPSP---------AVCSPKPQKKGSSLQEKKAETVKPSMSAGPGQV 112

  Fly   500 PT--------------TASCPTPARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLN 550
            |.              .|:|  ..|::.||.:..:||.|||..|.:.||||...|.|:|:...:.
  Rat   113 PNPLNFRERDLKKEPLEATC--QFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHEIAQMVGVT 175

  Fly   551 EARIQVWFQNRRAKYRKQEKQLQK 574
            ..||.|||||||||:||.||..:|
  Rat   176 PQRIMVWFQNRRAKWRKVEKLNEK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 26/52 (50%)
NoboxNP_001178942.1 COG5576 82..>192 CDD:227863 38/111 (34%)
Homeobox 138..191 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.