DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and Rhox10

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:71 Identity:27/71 - (38%)
Similarity:48/71 - (67%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQ 573
            :||.:...:|..|:.|||.||.::.|||.:.|:.||:...::|.:::.||:.:|||||:::|:|.
Mouse    86 SRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKELL 150

  Fly   574 KALAPS 579
            .:.|.|
Mouse   151 LSNATS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 19/52 (37%)
Rhox10NP_001020021.1 Homeobox 94..143 CDD:278475 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.