powered by:
Protein Alignment CG32532 and Rhox10
DIOPT Version :9
Sequence 1: | NP_608318.5 |
Gene: | CG32532 / 32943 |
FlyBaseID: | FBgn0052532 |
Length: | 688 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001020021.1 |
Gene: | Rhox10 / 434769 |
MGIID: | 3580249 |
Length: | 196 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 27/71 - (38%) |
Similarity: | 48/71 - (67%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 509 ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQ 573
:||.:...:|..|:.|||.||.::.|||.:.|:.||:...::|.:::.||:.:|||||:::|:|.
Mouse 86 SRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLIDVDECKVKAWFKYKRAKYRRKQKELL 150
Fly 574 KALAPS 579
.:.|.|
Mouse 151 LSNATS 156
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR24329 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.