DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and zen

DIOPT Version :10

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_476793.1 Gene:zen / 40828 FlyBaseID:FBgn0004053 Length:353 Species:Drosophila melanogaster


Alignment Length:121 Identity:26/121 - (21%)
Similarity:46/121 - (38%) Gaps:37/121 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KKLKNFIDNK--DPGFKIVKITVH-------QNSSD--MFMDREGGYTFVNDLPHGIVGRARRMC 75
            ||...|||.:  .|.:.:..|..|       :.|.|  ..:.::..:.|:||.        .|..
  Fly   217 KKSIEFIDYEYAFPNYALYDIANHFCEYAGVEGSPDYSKCLTKDEKWAFINDY--------LRFS 273

  Fly    76 KSKKNTHLDSLLGCLSVLMKNSELQLDSLDIIVYH--NHNTIVKWFEELVQSKNQT 129
            ..|:  |.|:.   ::.:.||         ::::.  .|.....|  .|||::|.|
  Fly   274 NGKE--HSDTR---IATMFKN---------LLLFEAAAHLFWAVW--ALVQAQNST 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeodomain 511..567 CDD:459649
zenNP_476793.1 Homeodomain 91..147 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.