DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32532 and mix1

DIOPT Version :9

Sequence 1:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster
Sequence 2:NP_988848.1 Gene:mix1 / 394439 XenbaseID:XB-GENE-485898 Length:357 Species:Xenopus tropicalis


Alignment Length:273 Identity:81/273 - (29%)
Similarity:109/273 - (39%) Gaps:71/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 MDSSSHH---HTPAHTPPSRLS-DHTISAEGAFKKLKPEPNSGLSTVS-AGI-TSPGSGLSSLSQ 494
            |||.|..   ..|:...||.|. :.|.....|.|..:..||....|:| ||. .||...:.: ..
 Frog     1 MDSFSQQLEDFYPSGFSPSPLGFNETEVQPFAMKDFQQPPNRREVTMSPAGSEQSPVQNIRT-KD 64

  Fly   495 HAGHTPTTASCPTP-------ARRRHRTTFTQEQLAELEAAFAKSHYPDIYCREELARTTKLNEA 552
            ..|...|....|.|       ::||.||.|||.||..||..|..:.||||:.||||||...:.|:
 Frog    65 TMGSKETDPRNPVPDASLLPASQRRKRTFFTQAQLDILEQFFQTNMYPDIHHREELARHIYIPES 129

  Fly   553 RIQVWFQNRRAKYRKQEKQLQKAL-------------------APSVIPSCNGM---------MR 589
            ||||||||||||.|:|..:..|.:                   ||:...|.:.|         |:
 Frog   130 RIQVWFQNRRAKVRRQGAKATKPVLAGHHYSSTFGATRSMFPSAPAPNSSSHPMATARAQAQPMK 194

  Fly   590 NIQG--YSVSRGYQPYPHHNTMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEF 652
            :.|.  :..|:|:.|||.                ||.....|.|.::.:|           .|.:
 Frog   195 DSQANKFHQSQGFLPYPD----------------SSCDVSRQRFLLSQAT-----------PGTY 232

  Fly   653 HGMSPEDEWYNKS 665
            |........||::
 Frog   233 HLPQTSSNIYNQN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 33/52 (63%)
mix1NP_988848.1 Homeobox 90..143 CDD:278475 33/52 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.